PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr026949.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family NAC
Protein Properties Length: 256aa    MW: 28858.8 Da    PI: 9.0633
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr026949.2genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.67.4e-51141381128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 
                  lppGfrFhPtdeelv +yL++k+ + +l++ ++i+evd++k++PwdLp      e+e yfFs+r+ ky++g+r+nrat sgyWkatg dk++++  +g
  Pbr026949.2  14 LPPGFRFHPTDEELVLQYLRRKAYSCPLPA-SIIPEVDVCKADPWDLPGD---CEQERYFFSTREAKYPNGNRSNRATCSGYWKATGLDKQIVTCrGG 107
                  79****************************.89***************44...46799*********************************9876589 PP

          NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                  ++vg+kktLvfy+g+ p+g++tdW+mheyrl
  Pbr026949.2 108 QVVGMKKTLVFYRGKPPHGTRTDWIMHEYRL 138
                  99***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.62E-6110173IPR003441NAC domain
PROSITE profilePS5100557.3714173IPR003441NAC domain
PfamPF023651.9E-2615138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0010089Biological Processxylem development
GO:0010150Biological Processleaf senescence
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MERISFVKNG VLRLPPGFRF HPTDEELVLQ YLRRKAYSCP LPASIIPEVD VCKADPWDLP  60
GDCEQERYFF STREAKYPNG NRSNRATCSG YWKATGLDKQ IVTCRGGQVV GMKKTLVFYR  120
GKPPHGTRTD WIMHEYRLVL PENPASIAAP EKNSTHSPVV PMDNWVLCRI FLKKRGGKNE  180
EEQVQQPSFN VRKPKNSRPV FYDFMTKDRE NLSLAPCSSS SGSSGITDVV SSEQVDNDHG  240
ESSSCNSLGL IRRKQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D4e-531217418169NAC domain-containing protein 19
3swp_C4e-531217418169NAC domain-containing protein 19
3swp_B4e-531217418169NAC domain-containing protein 19
3swp_A4e-531217418169NAC domain-containing protein 19
3swm_D4e-531217418169NAC domain-containing protein 19
3swm_C4e-531217418169NAC domain-containing protein 19
3swm_B4e-531217418169NAC domain-containing protein 19
3swm_A4e-531217418169NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00507DAPTransfer from AT5G13180Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009336457.10.0PREDICTED: NAC transcription factor 25-like
SwissprotQ9FY938e-99NAC83_ARATH; NAC domain-containing protein 83
TrEMBLD9ZJA01e-173D9ZJA0_MALDO; NAC domain class transcription factor
STRINGPOPTR_0001s13380.11e-130(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF70434139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.12e-99NAC domain containing protein 83